McDonnell Genome Institute

Washington University

CircRNA

chr3|193654861|193657232|+|OPA1|ENST00000361150.6

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9687

27

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

11

Peptide

VLNDTSGMTLR

Amino Acids from 5' Exons

GGNPSTIFVGKSINSCDKHLPSSCADHEFRNFHHSGYQATVDTTSSSR,EEILQQSLWERVSTHVIENIYLPAAQTMNSGTFNTTVDIKLKQWTDKQLPNKAVE,RKSFNNLCGKEYQLMLKTSTFQLRRPIQELLTPQWISSLNSGLINNFLIKQ

Amino Acids from 3' Exons

VAWETLQEEFSRFMTEPKGKEHDDIFDKLKEAVKEESIKRHKWNDFAEDSL,LLGRPYKKNFPALQNRKGKSMMTYLINLKRLLRKKVLNDTSGMTLRRTA,CLGDPTRRIFPLYDRTERERAHITRGCGRKYTTQVELCGGQL