McDonnell Genome Institute

Washington University

CircRNA

chr3|193615673|193626202|+|OPA1|ENST00000361150.6

Cancer

Type of Peptide

CRC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9327

7

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

13

Peptide

AAGQYSTSYAQQK

Amino Acids from 5' Exons

TFDQWKDMIPDLSEYKWIVPDIVWEIDEYIDF,LLISGKIYRTLVNINGLCLTLCGKLMSISIL,FSVERYDTGPIMDCAHCVGNVYRF

Amino Acids from 3' Exons

GLLGELILLQQQIQEHEEEARRAAGQYSTSYAQQKRK,VCLVSSFSYNNKFKSMKRKRAEPLANIARAMPNRSA,SAWAHSLTTTNSRARGSAQSRWPIHELCPTEAQ