McDonnell Genome Institute

Washington University

CircRNA

chr3|193284913|193319108|-|ATP13A5|ENST00000342358.8

Cancer

Type of Peptide

PRAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9959

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

2

Peptide

KPIYTNLPK

Amino Acids from 5' Exons

VFSGQPKFFNKCEFGKKLDWKCNSDSWFNFKFDHHTVAHHHHQLYHSSIHLFGKAISKTHLYK,ECFLANQSNFSTNVSLERNWTGNATLIPGSILSFETTTLWPITTINYITVAFIFSKGKPFRKPIYTN,SVFWPTKVIFQQMVWKETGLEMQLFLVQFVLRPPHCGPSPPSTISQHSSFLRESHFENPSIQT

Amino Acids from 3' Exons

CPRISHRNGVTRCKASVSLLLPTKPRWGIFQKSSTP,AQEFPTGTEELHGARLPCHCSCPQNLKDGESFRSRALSQ,PKNFPQELRSYTVQGFRVIALAHKTLKMGNLSEVEHLA