McDonnell Genome Institute

Washington University

CircRNA

chr3|191375061|191375589|+|CCDC50|ENST00000392456.3

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

12

Peptide

DNPHINNEQHER

Amino Acids from 5' Exons

TNQGQGGPGNWVLDSQDLVDSKEMERLSTRKRNQNIHWRTWKSQNNIVHRRDPCHPLARAKGGTIPILTMSSMKGNGPLRRGLGDLCFPRSVVKCFALNVMTGRLRLTIRLEIGKNSLDTKIDFHPSPHKKQGFTARKLYMGGTMGKVSTEKGDTGPGLLHSQRVRSSSTSMTQ,PTRVKEGQGIGFWILKTLTPKRWKDCEAQERETRTSTGELGRARTTLFIEEIPVILLGQREGQSPYQAAKETVHSGEASETSASHDQWSVSEHMLGDDPSDSKLGKTVSTPRSTFTQVLTKSRASLQGSCIWEGPWARAQKKETQAQDSSILREGAAPPPR,QPGSRRARELGSGFSRPCRLQRDGKTVKHKKEKPEHPLENLEEPEQHCSSKRSLSSSSSGKGRDNPHINNEQHERKRSTQERPRRPLLPTISGEVFLSTECDDWETKINHQTRNWEKQSRHQDRLSPKSSQKAGLHCKEVVYGRDHGQGEHRKRRHRPRTPPFSESEEQLHLHDA

Amino Acids from 3' Exons

TNQGQGGPGNWVLDSQDLVDSKEMERLSTRKRNQNIHWRTWKSQNNIVHRRDPCHPLARAKGGTIPILTMSSMKGNGPLRRGLGDLCFPRSVVKCFALNVMTGRLRLTIRLEIGKNSLDTKIDFHPSPHKKQGFTARKLYMGGTMGKVSTEKGDTGPGLLHSQRVRSSSTSMTQ,PTRVKEGQGIGFWILKTLTPKRWKDCEAQERETRTSTGELGRARTTLFIEEIPVILLGQREGQSPYQAAKETVHSGEASETSASHDQWSVSEHMLGDDPSDSKLGKTVSTPRSTFTQVLTKSRASLQGSCIWEGPWARAQKKETQAQDSSILREGAAPPPR,QPGSRRARELGSGFSRPCRLQRDGKTVKHKKEKPEHPLENLEEPEQHCSSKRSLSSSSSGKGRDNPHINNEQHERKRSTQERPRRPLLPTISGEVFLSTECDDWETKINHQTRNWEKQSRHQDRLSPKSSQKAGLHCKEVVYGRDHGQGEHRKRRHRPRTPPFSESEEQLHLHDA