McDonnell Genome Institute

Washington University

CircRNA

chr3|186725087|186739414|+|KNG1|ENST00000265023.8

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9938

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

31

12

Peptide

NLPYCQLSTTGNAEGPVVTAQYDCLGCVHPISTQSPDLEPILR

Amino Acids from 5' Exons

PRALWQPSTTASAVCILYQRRAQTWSPFDTAFSTLTTTLNIPPSSCLMKNGPKD,RGPCGDSPVRLPRLCASYINAEPRPGAHSETRHSVLQQHSTFLPLHASKTGPKT,EGPVVTAQYDCLGCVHPISTQSPDLEPILRHGIQYFNNNTQHSSLFMLNEVKRAQRQ

Amino Acids from 3' Exons

QSLDCNAEVYVVPWEKKIYPTVNCQPLGM,KAIATLKFMWYPGRKKFTLLSTVNHWE,KPRLQRSLCGTLGEKNLPYCQLSTTGN