McDonnell Genome Institute

Washington University

CircRNA

chr3|186671622|186675190|+|HRG|ENST00000495413.1

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9999

37

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

7

Peptide

SFTGGFR

Amino Acids from 5' Exons

SLQHWPIPKIVRSSISLRILSATENKPTKPLRSTKRRMMTLPLSEWTESRELQE,LFSTGQYQRSGPHRFLGYALQKTSQQSPEVQRGELCLFQSGPNRESCKS,SSALANTKDSPVLIDFFEDTERYRKQANKALEKYKEENDDFASFRVDRIERVARV

Amino Acids from 3' Exons

RGGEGTGYFVDFSVRNCPRHHFPRHPNVSIRNVCDRLESQRKKKEKKEKEKEKERKEKKEKRNEKEKMRRRRRRKKCLNTKYHLGSTYLPGTLLSDLHIRLIVLFCFDGVSLLLPRLECNGTVSAHCNLRLPGSGDSPASASGVTGITGMHHHAQLIFVFLVEMGFHHVDQVGLKLLISGVHPLRLGLQIKVLGLQAQATMPSLLINPHTTIDRYHFSQISRGNGTENISEPEHDFIIYMIYTTNVSNLGLKALELQFVLRPYAKWFYFHIITLTGIPLDKGGNKSAKERSCRCSQPSDNLVILIQSPVGFFLSFTNRFPCTCQKTLLIPPGICMVTYSRNTSTSVIARRASKSCQGKASICLHFLQGDLKLKPLTRHLARECEMEFLCQVQDFSEVQHILPGQKGETIHYLCLFCPHTRSRNLLSAHQKRHLPPLLLWPTNPSSWCGCKPRVEAPELKRRLRGKCFTASSCLINPSHNLVHSIIPILQWLTFRNLLLSQTQTTRKWRSQDHRSLFPNCTQNLNAQFLLADSRPLVLVDLSQVGLGASGAQEWQPVVALALGWSQQTLALTMSMKTHLYAIQMPSCPTLSSKGPAEVVKIPLHHSSLSAQATEVSSAEGLARQGSNDVVFLIISITHGEAQCWCLLMKKTTATLVIPFTTCTFPKVLTRKDCTTGGNISYYPDFSKALLPFLNVWKLTLAGHLHTTWTHTLTAPHSFVGLWILQSRFVLCRSLGLGKPEKPCHKLSLRPS,EEGKELVTSWTSLCGTAPDTISPDTPMVEMSVIVDSHREKRKRRRRRRRRRRGRRRRRRGMRRRKGGGEGGRNVCEIQSIIWEALSTCQALFVIYTSDNLLFCFVFEMEFRSCCPGWSAMAQCRLTATSASRVQAILLPQPPELGLQACTTTPSFLYFRWGFTMLIRLVSNSLSQVSTHFGWDYKSKCWGYRRKPPCPAYDNLLTLTLPYEIDTIFNPKLADRGTEAQRTANHKNMILYTYIPKLKTKFLTDDRLSNYSSSYDPTPSGFINSTSSHSQESHLTNEEVTENQQRKGLADVHNQAEIKTLFSYKVQWDFSSNHLQIDSHVPARRHYYHLAFAWPTVKETPPHLLLPGEPHENPADKEKQVSAYISCDKGTNNHLPKGTLESVRKWNFNYDAKSRIFLRFNNTFSLVKREKPSISTFVSSSNVHTEPGLETFLAPTRKDTSLPYSYGQQTLHDLGVDNVNPELKHQSRGGSGVSVLQHPLVLIPPTTCEYIVLSPFYNGLSEIFCNFPKLRQLGNGEARINIGLSDSQTVLRTSMLSNFFQTAVLLSSIFHRWVEHLEHRSGSQLPWHLGGVSRHLPQCPKPIFMLYRCPPVQHFPPRDQLKLKSLFDTIPHCPRHRQLRSPVQKGWPKGKAAMMWFSSSFPSPMGKPSAGACSKKPQQLYPSPPALSPKCQGKIAERLVGISDHITLIFLKHFFLFMSGSLWLVIFTPPGHTHQLLIPLVFGFCRADLFYDVEALDLESPKNLVINCEVFDPQ,RRGRNWLLRGLLCAELPQTPFPQTPQCEYKKCLSLTRVTEKKEREEGEGEGEGEEGEEGEEEEGENEEEEKEEEMSVKYKVSSGKHLVPARHSSKFTHQITYCFVLFLRWSFALVAQVGVQWHSVGSLQPPPPGFRRFSCLSLRSNWDYRHAPPRPANFCIFSRDGVSPCSGWSQTPYLRCPPTSAGITNQSAGVTGASHHAQPMITYPSHYHMRIPFLIPNQIGELRHREHKRTIRTFYNIHDIYLNLKLSFLIRIKGLVRTIAVRTKTLRQVVLLIPHHHTHRNPTQMRRLKISKGKVLPMFTTKLRLKLSYSHTKSSGIFPLIIYKIPMYLPEDIINTTWHLHGDLQLKKHLHICYCQESLMKILLTRKSKYLPTFPVTRGPEIKTTYLKALSRVLGNGILIMMPSPGFFGLTTHSPWSKGRNHPLVPLLALLMSTLNQVKPSRPPEKTPPSPTPMANKPFMILVWIMTQSSTRAEEEAQGVFYSILLFNSLPQPVSTYYPHFTMADFQKSFVTFPNSDNEMEKPGLTVSLIPKLYSEPQCLAISSSRQPSSCPSRSFTGGFRSIWSTGVAASCSPGTWVESADTCLDNVHENPSLCYTDALLSNTFLQGTSSCKNPSLTPFLIVLGTGNGLQCRRVGLKARQQCGFPHHFHHPWGSPVLVPAHEKNHSNFSDTLHHLHFPQSVNKERLLNDWWEYLIILPFFSTSSFSECLEANSGWSSSHHLDTHTNSSSFLCRSLDSAEQICSMMKPWTWKARKTLSTVKSSTL