McDonnell Genome Institute

Washington University

CircRNA

chr3|185511523|185535132|-|LIPH|ENST00000296252.8

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.998

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

20

Peptide

NMSFIHQAELSQCSGWYGTK

Amino Acids from 5' Exons

THHISEISPSESTCKISRSGSGCNFLDVLYRISNRPKVQAQDSPNEVKVPCPSGE,EPTTFQKYHQVSLLARFNQDLDKVAAISLMFSTGSLIGPRYKLRILRMKLRSLAHPE,NPPHFRNITKVYLQDLIKIWIKWLQFPCSLQDLAQGTSSGFSESGPLPIRR

Amino Acids from 3' Exons

TQKKHVLHSPGAFTVQWLVRDMGCSTQGKTPAHKPSTPQLLGTMPRKPPSLSMDSGQQAPLLFGWMTRVCSLLKTTLLLIGIEELQLYIPMPLVRPEKPWSRNLLTRC,RRRNMSFIHQAELSQCSGWYGTKCEADALHKEKPDLRTNHQLLSFWELECDQENHLHCPWIQANRLPSCLDGLSKGFALCRHERSCCLESRSYNFNIYPCLDQKSSHGLEGIYPDV,AEETCPSFTRLSFHSAVVGTGLNVRLMLYTRKNLTCAQTINSSAFGNLNVTKKTTFIVHGFRPTGSPPVWMDDLVKGLLSVEDMNVVVVDWNRGATTLIYTHASSKTRKVAMVLKEFIDQML