McDonnell Genome Institute

Washington University

CircRNA

chr3|184580728|184581165|+|EPHB3|ENST00000330394.2

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9982

1749

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

7

Peptide

SLPALSLGR

Amino Acids from 5' Exons

GGKIPIRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQD,AGRSPSAGLPQRPPIGSSLLLVMSGATELSCGRSAMESDPTGTATR,REDPHPLDCPRGHSLSEVHFCCLELRNCHVGGHELWRATLLGHEQPG

Amino Acids from 3' Exons

VINAVEQDYRLPPPMDCPTALHQLMLDCWVRDRNLRPKFSQIVNTLDKLIRNAASLKVIASAQS,SSMPWSRITGCHHPWTVPQHCTSSCWTAGCGTGTSGPNSPRLSIPWTSSSAMLPASRSLPALSL,HQCRGAGLPAATTHGLSHSTAPAHAGLLGAGPEPQAQILPDCQYPGQAHPQCCQPQGHCQRSVW