McDonnell Genome Institute

Washington University

CircRNA

chr3|183643479|183651276|+|KLHL24|ENST00000242810.10

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9418

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

14

Peptide

MSFLTSLQDHPMPK

Amino Acids from 5' Exons

VWKLKEHTYFDWGFDQPNAKK,CGNKNTHILTGALINQMLK,VEIKRTHIFLGLSTKCK

Amino Acids from 3' Exons

PHKEDPSFLNNYIVNCNNGTNIGTQTKQRGSWGAFPSNAKSFNGPQISDRSVFLLFRIIPCRKHTPDIISPLIHRCYHLCGRKRISLPSCALSLQLLQSYVLPQGKPRNVGDQWYFSSYGMFFAVCLYWKGEDHYRECTVSLDIKPLSDCSPCMCQVLGGATSLLLRNPALCYPFTQNTLHKMQKFCVTDFGCIPARRISAQRTYLYLTCYWRGDGFSRHALGLSCRSEKTTVTRAPDTCETPSVASQLLCSNSSGPIDPEFSVLSVVASKTVPHTWENDVPKDATQ,HIKKIPNSHFSTIISTDVTMVLILGRRLNREDLGVRDSPATKRKVFEMDPKSLTGHEFFDFSSGSSHAENILQIFNEFRDSRLFTDVIICVEGKEFPCHRAVLSACSSYFRAMFCNDHRESREMLVEINGILAEAMECFLQYVYTGKVKITTENVQYLFETSSLFQISVLRDACAKFLEEQLDPCNCLGIQRFADTHSLKTLFTKCKNFALQTFEDVSQHEEFLELDKDELIDYICSDELVIGKEEMVFEAVMRWVYRAVDLRRPLLHELLTHVRLPLLHPNYFVQTVEVDQLIQNSPECYQLLHEARRYHILGNEMMSPRTRPR,TRRSLIVISQQLYSQLMQWYYWDADTERILGCVIPQQLSEKFLKWTPNLQVMSFLTSLQDHPMPKTYSRYLMNFVIAAYSQMLSFVWKEKNFLAIELCSQPVAATSELCFVMTTGKAEKCWLRSMVFLKLWNVFCSMFILERRSLQRMYSISLRHQASFRLVFSVMHVPSSWRSNLILVIAESSALLIPIHSKHSSQNAKILRYRLLRMYPSTKNFLSLTKMNLLIIFVVMNLLLVKRRWFLKPSCVGSIVPLIEDHCYTSSHMDSLCCIPTTLFKQLKWTNSRILLSVISCCMKQDGTTYLGMKCPQGLGHA