McDonnell Genome Institute

Washington University

CircRNA

chr3|182836034|182898772|+|ATP11B|ENST00000323116.9

Cancer

Type of Peptide

PRAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9971

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

2

Peptide

AQGYEDWLR

Amino Acids from 5' Exons

GYEDWLRHNSDNEVNGAPVYVVRSGGLVKTRSKNIR,DMKIGYGITQIMKMELLFMLFEVVALKLDQKTF,IRLVTALRSKWSSCLCCSKWWPCKNIKKHS

Amino Acids from 3' Exons

AIFGLPEYVFCVYSAPVKWFCLVCHNPHGCYMSISYHKEGLPTPPPYKYKGT,PFLGSQNMYFVFIQLLSSGSAWFAIILMVVTCLFLDIIKKVFDRHLHPTSTEKAQ,HFWAPRICILCLFSSCQVVLLGLPSSWLLHVYFLISRRSLTDTSTLQVLKRH