McDonnell Genome Institute

Washington University

CircRNA

chr3|180933333|180963090|+|FXR1|ENST00000472339.5

Cancer

Type of Peptide

PRAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9999

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

16

Peptide

GYATDESTVSSVQGSR

Amino Acids from 5' Exons

GFIKDVHEDSLTVVFEN,DLSKMFMKTPLQLFLKI,IYQRCSRLPYSCFK

Amino Acids from 3' Exons

EVEQLRMERLQIDEQLRQIGMGFRPSSTRGPEKEKGYATDESTVSSVQGSRSYSGRGRGRRGPNYTSGY,KNSEWNAYRLMNSCDRLVWVSDLLPPEGLKKRKDMPLMKVPSLLYKVLGLIAEEAEVVGDLITPPVM,SRTAKNGTPTDTAATDWYGFQTFFHQRAKRERICHKYRLFCTRFVLRKRQRSSGTLHLRL