McDonnell Genome Institute

Washington University

CircRNA

chr3|179745042|179752373|+|USP13|ENST00000263966.7

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9094

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

2

Peptide

FDELIAYELTR

Amino Acids from 5' Exons

MNSLMNREGKQKQTEDPFLSWYVPRYHLVPAFRPSLNQKMLMISGAVPYKQSLRV,TDRLTNEKGSRSKQKTPSVGTCQDTICLPSGLLTRKCFLEQCPTSKVCGCE,ELIAYELTRREAEANRRPLPELVRAKIPFSACLQAFSEPENVDDFWSSALQAKSAGV

Amino Acids from 3' Exons

NISLCFIPILGSADKEVHFWSLGSQKI,TSRFASFPEYLVVQIKKFTFGLDWVPKKF,HLALLHSLNTWCRRSSLLVLTGFPKNL