McDonnell Genome Institute

Washington University

CircRNA

chr3|179203543|179209700|+|PIK3CA|ENST00000263967.3

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9092

12

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

4

Peptide

GAKEYIR

Amino Acids from 5' Exons

YIRSCIMLGRMPNLMLMAKESLYSQLPMDCFTMPSYSRRISTATPYMNGETSTKSLWVINSALRIKILCATYVNVNIRDIDK,IEAVCLGGCPICWLKKAFILNCQWTVLQCHLIPDAFPQLHHIMEKHLQNPFGLIVHSEKFFVQPTMIFETLI,YKKLYNAWEDAQFDVDGRKPLFSTANGLFYNAILFQTHFHSYTIYEWRNIYKIPLGYKCTQNKNSLCNLRECKYSRH

Amino Acids from 3' Exons

VEMAELYIHSSSSCCSTLPFHLLCRPKGCR,WNEWLNYDIYIPDLPRAARLCLSICSVKGRKGAKE,GMNGIMIYTFLIFLVLLDFAFPFALLKAERVLK