McDonnell Genome Institute

Washington University

CircRNA

chr3|171157459|171190787|-|TNIK|ENST00000284483.12

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9362

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

9

Peptide

LEEGLSHLHQHK

Amino Acids from 5' Exons

LHPESARGVDAAEGLSEAAAGQQGAFGPTEAAAGAAAAGEGAQAAAAGRASEAHRGAERAEAAAGG,SILNLPGESTLRRDFLRLQLANKERSEALRRQQLEQQQRENEEHKRQLLAERQKRIEEQKEQRRRLEE,PSICQGSRRCGGTFGCSWPTRSVLRPYGGSSWSSSSGRMRSTSGSCWPSVRSASRSRKSRGGGWR

Amino Acids from 3' Exons

GLSHLHQHKVIHRDIKGQNVLLTENAEVKL,GVTCTSIKFIEILKGKMSCLKMQKLN,AESPAPASDSSRYRAKCLADKCRST