McDonnell Genome Institute

Washington University

CircRNA

chr3|171101448|171110877|-|TNIK|ENST00000284483.12

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.994

13

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

5

Peptide

LINPDLR

Amino Acids from 5' Exons

DLTALAKELRELRIEETNRPMKKVTDYSSSSEESESSEEEEEDGESETHDGTVAVSDIPRL,IRHPKNENSGLKKQTAQRRLITPPPVRSQKVARKRRKMERARPMMGQWLSATYPD,SDGISQRTKRTPDRNKPPNEEGDLLLLQGVRKRGRGGRWRERDPWDSGCQRHTQTD

Amino Acids from 3' Exons

QPSPENAHLGEPLAEDQQWQFLQLQHPLPAQLPRRLPAWITSRIQTHQSS,NPDLRRTEPILESPLQRTSSGSSSSSSTPSSQPSSQGGSQPGSQAGSSERTRVR,TLISGELSPSWRAPCRGPAVAVPPAPAPLAPSPAPKEAPSLDHKQDPVNAPEFE