McDonnell Genome Institute

Washington University

CircRNA

chr3|171079517|171101633|-|TNIK|ENST00000284483.12

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9364

20

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

7

Peptide

LDLTALAK

Amino Acids from 5' Exons

ERRISYEFTIFHGETEYYIMTQKKRNKAGSLLGTWKAVYIIKL,KEEATSLLSFMVKKQNTTPRSRKETRLDHCWGLGRLYTLS,KKNKLRVYYLSWLRNRILHNDPEVEKKQGWITVGDLEGCIHYKV

Amino Acids from 3' Exons

DLTALAKELRELRIEETNRPMKKVTDYSSSSEESESSEEEEEDGESETHDGTVAVSDIPRL,IRHPKNENSGLKKQTAQRRLITPPPVRSQKVARKRRKMERARPMMGQWLSATYPD,SDGISQRTKRTPDRNKPPNEEGDLLLLQGVRKRGRGGRWRERDPWDSGCQRHTQTD