McDonnell Genome Institute

Washington University

CircRNA

chr3|169088999|169143832|-|MECOM|ENST00000264674.7

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9896

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

9

Peptide

SQILDEFYNVK

Amino Acids from 5' Exons

VRGRIKWTFCSRSYKALHRPQNEENGRSIFSAVFFYFPCARGTAAVTQKVQIA,YKEEEYKSGLSALDHIRHFTDSLKMRKMEDNQYSEAELSSFSTSHVPEELKQPLHRKSKSQ,IKRKNIKVDFLLIIGTSQIASKGKWKIINILKLSCLLLVLPMCQRNLSSRYTESPNR

Amino Acids from 3' Exons

ILDEFYNVKFCIDASQPDVGSWLKYIRFAGCYDQHNLVACQINDQ,STNFTMSSAMPVNQMLEAGSSTLDSLAVMISTTLLHARMI,LRRILQCEVLHRCQSTRCWKLAQVHIRWLLSAQPCCMPDKS