McDonnell Genome Institute

Washington University

CircRNA

chr3|167317004|167333985|-|ZBBX|ENST00000307529.9

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9993

8

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

2

Peptide

IVELDDAK

Amino Acids from 5' Exons

VRRPKYNTQLFYCQKHTRDLNHLRSNWM,GDQSTTHSSFIASRNIKHRETTISKDSRTG,EETKVQHTALLLPVETLNIERPEPSLKIVELDD

Amino Acids from 3' Exons

AKSQILFNVLDVAHQFIKDVNPDEPKEENNSTKETSKIQHKPKSVLLQRSSSE,QNLKYYSMYWMLPISLRMLIQMNPKRRIILQRKPVKFNINPNLYFSRGAAL,KISNIIQCIGCCPSVYKGCSRTQRGEFYKGNQNSTTQICTSPEEQL