McDonnell Genome Institute

Washington University

CircRNA

chr3|16493724|16493877|-|RFTN1|ENST00000334133.8

Cancer

Type of Peptide

BRCA-HER2-enriched

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9807

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

10

9

Peptide

FLEFTTLSAAAEMGCGLNK

Amino Acids from 5' Exons

LLKWVADTSRNVMKNGLGIFIQLRGLRWKPRMCPMNTASWSSRLVL,CNGLRIEQVRETKTAWEYLFNFEEASGGNQDRCVLIPLPGVHDSEC,AEMGCGLNKLEKRDEKRPGNIYSTLKRPQVETKIDVSYEYRFLEFTTLSA

Amino Acids from 3' Exons

LLKWVADTSRNVMKNGLGIFIQLRGLRWKPRMCPMNTASWSSRLVL,CNGLRIEQVRETKTAWEYLFNFEEASGGNQDRCVLIPLPGVHDSEC,AEMGCGLNKLEKRDEKRPGNIYSTLKRPQVETKIDVSYEYRFLEFTTLSA