McDonnell Genome Institute

Washington University

CircRNA

chr3|160420739|160430743|+|SMC4|ENST00000344722.5

Cancer

Type of Peptide

OSCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9829

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

6

Peptide

NTNAAEGDLGAIDEK

Amino Acids from 5' Exons

GDLGAIDEKYDVAISSCCHALDYIVVDSIDIAQECVNFLKRQNIGVATFIGLDK,GTEPLMKNTTWLYHPVVMHWTTLLLILLIPKNVTSLKDKILELQPLVI,GLRSHKIRRGYIILLSCTGLHCCFYYSPRMCKLPKTKYWSCNLYRFR

Amino Acids from 3' Exons

KPSKGTRLCLAYRERNKRYERGGPNSRAEKSGQSSRGRKEYKCCR,NLQKAQDSVLRTEKEIKDTEKEVDDLTAELKSLEDKAAEVVKNTNAAE,TFKRHKTLSCVQRKKKILRKRWMTQQSKVLRTKQQRSRIQMLQ