McDonnell Genome Institute

Washington University

CircRNA

chr3|160419357|160425019|+|SMC4|ENST00000344722.5

Cancer

Type of Peptide

OSCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9752

43

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

6

Peptide

FTASIQK

Amino Acids from 5' Exons

KEKELQKLTQEETNFKSLVHDLFQKVEEAKSSLAMNRSRGKVLDAIIQEKKSGRIPGIYGRL,KKKNFKNLHKKKQTLKVWFMISFKKLKKQRAHQIEVGGKSLMQFKKKNLAGFQEYMED,RKRTSKTYTRRNKLKFGSSLSKSRSKELISNESKGESPCNNSRKKIWQDSRNIWKI

Amino Acids from 3' Exons

VNKMESQLQNDSKKAMQIQEQKVQLEERVVKLRHSEREMRNTLEKFTASIQ,TKWNHSCKTTLKKQCKSKNRKYNLKKELSYGIVNEKGTHKNLLQAS,KQNGITVAKRLKSNANPRTESTTRKSSVTATRNEEHTRKIYCKHP