McDonnell Genome Institute

Washington University

CircRNA

chr3|160413472|160426200|+|SMC4|ENST00000344722.5

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.986

9

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

1

Peptide

AIYYQMK

Amino Acids from 5' Exons

LVAETNCNGNSKGKNSRYQRNEEQYTIKNESERCKRYRK,YELQKRIAEMETQKEKIHEDTKEINEKSNILSNEMKAKNKDVKDTE,MSCRNELLKWKLKRKKFMKIPKKLMRRAIYYQMKKLRIKMKIQK

Amino Acids from 3' Exons

RLIEQEEYLNVQVKELEANVLATAPDKKKQKLLEENVSAFKT,VSKKNIMSKLRNLKLMYLLQPLTKKSRNCKKTLVLSKQ,FNRARRIFECPSGTSCTCYSPQKKAEIARRKRCFQN