McDonnell Genome Institute

Washington University

CircRNA

chr3|15737032|15795306|-|ANKRD28|ENST00000399451.6

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9958

210

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

13

16

Peptide

TALHHAAFSGHGEPSLVQAIFNGDPDEVR

Amino Acids from 5' Exons

EAVQVLLKHSADVNARDKNWQTPLHIAAANKAVKCAEALVPLLSNVNVSDRAGRTALHHAAFSGHGE,KQFRYFSILQMLMLETKIGKPLYILLLIKLSVLKLWYLFVMTYLIEQGGLHYIMQLSVDMV,SSSGTFEAFCRCCSRQKLANPFTYSCCSCKVCSFGTSSECKRISSREDCITSCSFQWTW

Amino Acids from 3' Exons

PSLVQAIFNGDPDEVRALIFKKEDVNFQ,HHWCKLYLTEILMKFEHYLRKKMLTF,ITGASYIRRSSSSTNIERRCLS