McDonnell Genome Institute

Washington University

CircRNA

chr3|15712139|15724524|-|ANKRD28|ENST00000383777.5

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9848

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

6

Peptide

LLSSGHIEVVK

Amino Acids from 5' Exons

AWHTWNVPPPFGSLKRLFRLLQKTSFF,RGIHGMFPLHLAALSGFSDCCRKLLSS,VAYMECSPSIWQPAAFQIAAENFFLQ

Amino Acids from 3' Exons

VTLKNCLCRMELKHARIKSLIHLFMQQPLVESASSTFILEL,SHSSEIACVAWSSDMQGKVLYTSSCSSLWNDQRSQVPSRSWS,HIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLDLGVD