McDonnell Genome Institute

Washington University

CircRNA

chr3|156829285|156852982|+|LEKR1|ENST00000356539.8

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9255

25

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

7

Peptide

AMEEKVK

Amino Acids from 5' Exons

ISFGFKALSPYFGKLWIITFPCMRCLKKSK,FPLASKLSHHILGSYGSSHSHACVARNPK,FLWLQSSLTIFWEVMDHHIPMHALPEEIQK

Amino Acids from 3' Exons

MLPEEKVCKYCGVSYLILHEFKAMEEKVKAMEKEMKFYQGSVDREKRLQEKLHSLSQELEQYKIDNKSKTE,CCLKKKFVSTVESAIFFMNLRLWKKKKQWKKRNFIKEVIVKRDFKKSCILLAKNLNSTKLTTNPKQK,VARKSLVLWSQLSNSSIGYGRKSESNGKRDEILSRKCRSKETSRKAAFSPRTTVQNQQIQNRK