McDonnell Genome Institute

Washington University

CircRNA

chr3|15563357|15586602|-|HACL1|ENST00000321169.9

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9537

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

5

Peptide

AQVEACR

Amino Acids from 5' Exons

GPSNVFAAKFTLASHDCIWRQRVFCTNTRRTPKIPEAEPSRHNTFSYQHHDATSHTEGP,VPPMCLLPNSHYEQVMTAFGGKGYFVQTPEELQKSLRQSLADTTKPSLINIMIEPQATRKAQ,SLQCVCCQIHIMSKSLHLEAKGILYKHQKNSKNPGRAQTQLNLLLSTSLSHKPHGRP

Amino Acids from 3' Exons

VEACRLYTKFSARPSSIEAIPFVIEK,LKLVDYIPSSLPAQAAKLFLLLLK,SLIIYQVLCPPKQHRSYSFCYK