McDonnell Genome Institute

Washington University

CircRNA

chr3|155497319|155514884|-|PLCH1|ENST00000334686.6

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9377

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

14

Peptide

TLWMTSNGTTEHQVESFIR

Amino Acids from 5' Exons

IGSPKENHEALPRTLFGCVHKLRGRSGHCG,LGRRRKTMKLCRELSDLVVYTNSVAAQDIVDD,WVAEGKPSSAENSLIWLCTQTPWPLRTLWMT

Amino Acids from 3' Exons

SNGTTEHQVESFIRKKLESLLKESQIRDKEDPDSFTVRALLKATHEGLNAHLKQ,VMGPLSIRWNLSGKNWSHCKNLKFEIKKILIVSQCGHYRPRMKAMHTS,WDHASGGIFHKEKTGVTVKRISNSRRRSFHSAGTTEGHARLKCTPEA