McDonnell Genome Institute

Washington University

CircRNA

chr3|15414020|15425089|-|METTL6|ENST00000383790.7

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9622

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

10

5

Peptide

MGPDHIFLLMFEDQK

Amino Acids from 5' Exons

VLKPGKSVLFRDYGLYDHAMLRFKASSKLGENFYVRQDGTRSYFFTD,YNQAKVSCFVTTDCMIMPCLGLKPAANLEKTFMLDKMGPDHIFLLM,IKTRQKCLVSLRTVSCHAVSQQQTWRKLLCTRWDQIIFFY

Amino Acids from 3' Exons

FEDQKLTMLEAGCGVGNCLFPLLEEDPNIFAYACDFSPRAIEYVK,LKIKSQCLKLAVGLETVYSHFKKIRISLPMPVIFLQEPLNML,RSKVNNASWLWGWKLFIPTFRRRSEYLCLCLFFSKSHIC