McDonnell Genome Institute

Washington University

CircRNA

chr3|149210166|149212698|-|CP|ENST00000264613.10

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9364

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

8

Peptide

GNIPISIFK

Amino Acids from 5' Exons

GPSTLITPQIFKEQMTKYIQESSIHTCCLPLKNKVLGKEMAIVLGFTIPTLMLQKILPQDSSDLSVKK,GHLPHHRFSKSRQSISRRAVYIHVACHRTKSWGRRWQLCDDLPFPHCSKRYCLRTHRTFNNLK,AIYPDNTTDFQRADDKVYPGEQYTYMLLATEEQSPGEGDGNCVTRIYHSHIDAPKDIASGLIGPLIICKK

Amino Acids from 3' Exons

GTFQYLSSKWPRNWETIEGPLSSVHRNLDNYRKTGLAWVFRPYYQSNWRSLCTLKKPCLALHLSFTWNNLLGT,EHSNIYLQNGPDRIGRLYKKALYLQYTDETFRTTIEKPVWLGFLGPIIKAETGDKVYVHLKNLASRPYTFHSHGITYYKEHE,NIPISIFKMAQIELGDYIRRPFIFSTQMKPLGQLKNRSGLGFALLSKLKLEIKFMYTKTLPLGPTPFIHMELTIRNMR