McDonnell Genome Institute

Washington University

CircRNA

chr3|149198366|149210379|-|CP|ENST00000264613.10

Cancer

Type of Peptide

PRAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

2

Peptide

MYYSAVEPTK

Amino Acids from 5' Exons

VCLLQPPMWHPQKHSPMNGLSPKKDPLMQILCVLRCIILLWNPLKIYSLGLLGQKYARKEVYMQMGD,CASFSLPCGTHRNIHLMDCPQRSRTHCRSCVSSDVLFCCGTHRYIHWAYWANENMQERKFTCKWET,VPPSASHVAPTETFTYEWTVPKEVGPTNADPVCLAKMYYSAVEPTKDIFTGLIGPMKICKKGSLHANGRQ

Amino Acids from 3' Exons

GPSTLITPQIFKEQMTKYIQESSIHTCCLPLKNKVLGKEMAIVLGFTIPTLMLQKILPQDSSDLSVKK,GHLPHHRFSKSRQSISRRAVYIHVACHRTKSWGRRWQLCDDLPFPHCSKRYCLRTHRTFNNLK,AIYPDNTTDFQRADDKVYPGEQYTYMLLATEEQSPGEGDGNCVTRIYHSHIDAPKDIASGLIGPLIICKK