McDonnell Genome Institute

Washington University

CircRNA

chr3|149185238|149207617|-|CP|ENST00000264613.10

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9843

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

19

Peptide

SCIIYKSRTVNGYTFGSLPGLSMCAEDR

Amino Acids from 5' Exons

GLLMLNALQLIITQAASKNILTNAGGSLRIPPSTWERGHTISQQWRWNGIIPHKGSGKRSCIIYKSR,DFCMPYNSLHRRHEAKIYCEPMQAAVGFHLLPGREDILYRSSGGGMGLFPTKGVGKGAASFTRAE,TFNVECLTTDHYTGGMKQKYTVNQCRRQSEDSTFYLGERTYYIAAVEVEWDYSPQREWEKELHHLQEQ

Amino Acids from 3' Exons

LMDTLLEVSQDSPCVLKTENGTFLVWVMKLMCTQLSFTGKHLTRTTVLTQSTSFLLPCLMLIWWPRTLENGCSAVRITIK,CEWIHFWKSPRTLHVCRQSKMVPFWYGSCARSFLSRASTDQELPYHNQPLSCYPVCLYGGPEPWRMDAQLSESKPSE,VNGYTFGSLPGLSMCAEDRVKWYLFGMGNEVDVHAAFFHGQALTNKNYRIDTINLFPATLFDAYMVAQNPGEWMLSCQNLNHLK