McDonnell Genome Institute

Washington University

CircRNA

chr3|149039048|149040156|-|HLTF|ENST00000310053.9

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9221

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

4

Peptide

VFLMDPPHAK

Amino Acids from 5' Exons

SLWICVYSFGWFHGPKEKSINSVFSKHSRISNYNASVLKSRWSWFESVCSFSSVFNGS,ASGFVFTRLDGSMAQKKRVESIQCFQNTEAGSPTIMLLSLKAGGVGLNLSAASRVFLMDP,PLDLCLLVWMVPWPKRKELNQFSVFKTLKQDLQLCFCPKQVELVICLQLLECFWI

Amino Acids from 3' Exons

PHAKCPLCRNDIHEDNLLECPPEELARDSEKKSDMEWTSSSK,HMLNALYAEMIYMKIIYNVLQKNHVTVRKSLIWNGHPVQ,TCMPFMQKYTRFIRMSSRRISTQEKVYGMDIQFK