McDonnell Genome Institute

Washington University

CircRNA

chr3|146079115|146088711|-|PLOD2|ENST00000282903.9

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9997

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

20

Peptide

EMVHPNVSIGVFIEQPTPFLPR

Amino Acids from 5' Exons

RSMECPIYGCVLNRKDTPIRDEKELFCSTGSYGSLPKCRN,GVWNVPYMANVYLIKGKTLRSEMNERNYFVRDKLDPDMALCRNAREM,EYGMSHIWLMCTLKERHSDQRMKGTILFVINWILIWLFAEMLEK

Amino Acids from 3' Exons

VHPNVSIGVFIEQPTPFLPRFLDILLTLDYPKEALKLFIHNK,SIQTYQVFLLSNQPLFYLGFWTYCHWITQKKHLNFLFIT,PSKRINRCFYATNPFSTSVSGHIVDTGLPKRSTTFYSQ