McDonnell Genome Institute

Washington University

CircRNA

chr3|142736378|142781029|+|TRPC1|ENST00000273482.10

Cancer

Type of Peptide

BRCA-Luminal B

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9707

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

2

Peptide

EVTIIWLK

Amino Acids from 5' Exons

VTIIWLKRFWRKTVQVTTIAMCLGEMLLPLLKTKTWIYCSFFWTTVV,LLYGKDFGGKQFRLEHKLRRCAWEKCCYHNYKRKLGYTAASFGLRLS,DYYMVKKILEENSSGDLNINCVDVLGRNAVTITIENENLDILQLLLDYGCQ

Amino Acids from 3' Exons

ELGTSPAMNVCGFTCTSPEFSIGSYSKPYVRASQTGIIRRKNEFKSSKTCYQIPER,NDYEELARQCKMFAKDLLAQARNSRELEVILNHTSSDEPLDKRGLLEERMNLSRLKLAIKYNQKE,MIMRNPGNVKCLLRIYLHKPGILVNWKLFTIRLVTSLLTNGDYKKEIVVNLLSNITRK