McDonnell Genome Institute

Washington University

CircRNA

chr3|142453127|142505303|-|ATR|ENST00000350721.8

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9508

9

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

10

2

Peptide

LNETGEVVNEKK

Amino Acids from 5' Exons

CLKDFSTSSCGMETSERAFQSATENWRSCQK,VLKTFLHDPLVEWSKPVKGHSKAPLNETGEVVNEK,SRLFYMILLWNGVNQKGIPKRHMKLEKLSMK

Amino Acids from 3' Exons

KLYAAMHEPDGVAGVSAIRKAEPSLKEQILEHESLGLLRDATACYDRAIQLEPDQ,NCMLLCMNLMEWPESVQLERQNHLKNRSLNMKALACGMPLLVMTGLFSNQT,IVCCYATWSGRSQCNKGRTISKRTDPTKPWLAEGCHCLLQGYSARTRP