McDonnell Genome Institute

Washington University

CircRNA

chr3|14152334|14173062|-|XPC|ENST00000285021.11

Cancer

Type of Peptide

BRCA-Luminal A

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9813

7

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

14

2

Peptide

LCAHSAFQGHVAEESK

Amino Acids from 5' Exons

GLCAHSAFQGHVAEESKSGEAWRSTLQ,DCVHTLHSRDTWLKKARVVRLGEVPYK,IVCTLCIPGTRGRKQEWGLEKYPT

Amino Acids from 3' Exons

MPLKMRNPQRRAFSPKFHKERGKEAAVILGVQQMVQQKRKWPRLLNLKTSRLRMKPSAMGMTS,CLRETPKEEPSLQSFTRKEEKRLQSSWGFSRWSSKKESGQGDCIKPQGYKGSPQRWGPQ,AFEDEKPPKKSLLSKVSQGKRKRGCSHPGGSADGPAKKKVAKVTVKSENLKVIKDEALSDGDDL