McDonnell Genome Institute

Washington University

CircRNA

chr3|138714467|138737886|-|PIK3CB|ENST00000289153.6

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9494

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

15

Peptide

VDVFSFQVSPNMNPIK

Amino Acids from 5' Exons

VHVRAGLFHGTELLCKTIVSSEVSGKNDHIWNEPLEFDINICDLPRMARLCFAVYAVLDKVKTKKSTKTINPSKYQTIRKAGKV,FMSGLVFFMVLSSCVKPSAQRYQGKMIIFGMNHWNLILIFVTYQEWLDYVLLFMQFWIKKRRNQRKLLIPLNIRPSGKLEK,SCQGWSFSWYAPVNHRKLRGIREKSYLETTGIYYLLTKNGSIMFCCLCSFGSKNEEINENYSLISDHQESWKS

Amino Acids from 3' Exons

DVFSFQVSPNMNPIKVNELAIQKRLTIHGKEDEVSPYDYVLQVSGRVEYVFGDHPLIQFQ,TCLAFKCLLIILSKMNWQSKNVLFMGRKMKLAPMIMCCKSAGENMFLVIIHFSS,RVLSSVSYESYQSKIGNPKTFDYSWEGRSPLLCVASQRESRICFWSSTNSVP