McDonnell Genome Institute

Washington University

CircRNA

chr3|138665035|138683787|-|PIK3CB|ENST00000289153.6

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9173

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

3

Peptide

EYNSGVEK

Amino Acids from 5' Exons

DVALWLFSNRRSLWPHSCEHLNNCHSAEQQCGCCSSLQQRCPSELARIQLW,MLPYGCLATGDRSGLIEVVSTSETIADIQLNSSNVAAAAAFNKDALLNWLKEYNS,CCLMAVQQEIALASLKLAPLKQLLTFSTVAMWLLQQPSTKMPFTGLKNTTL

Amino Acids from 3' Exons

CKVQIHGFQNEAFVAGIQQGIWGFSWSDFKW,VEKCKYMDSKMKPLWLVYNNKVFGEDSVGVIFKNGD,LKSANTWIPKSLCGWYTITRYLVRIQLEFLKMVM