McDonnell Genome Institute

Washington University

CircRNA

chr3|138663905|138712304|-|PIK3CB|ENST00000289153.6

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9812

56

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

15

Peptide

TGQHYPVAWVNTMVFDFK

Amino Acids from 5' Exons

GPGPSHGIYTVLCWLLCSFLCPWDWQTQHHGQKNWP,DDLDRAIEEFTLSCAGYCVASYVLGIGDRHSDNIMVKKTGQ,MTWTEPLRNLHCPVLATVLLMSLGLVTDIVTTSWSKKLA

Amino Acids from 3' Exons

HYPVAWVNTMVFDFKGQLRTGDIILHSWSSFP,IILRGIRWFLTLKDNELETYYTAGLHFL,LSCSVGKYDGFLRTIENWRHNITQLVFIS