top of page

McDonnell Genome Institute

Washington University

CircRNA

chr3|138621406|138622416|+|FAIM|ENST00000338446.8

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9113

27

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

3

Peptide

IVLALLTA

Amino Acids from 5' Exons

PSLQPRKNDRSRSCLGCCFKRSPQDRITWDYIRQTSSICRWK,PPYSLEKMTDLVAVWDVALSDGVHKIEFEHGTTSGKRVVYVDGK,LLTAKKQISLFGMLLVTESTRSNLNMGLHQANEYMME

Amino Acids from 3' Exons

EEIRKEWMFKLVGKETFYVGAAKTKATINIDAISGFAYEYTLEINGKSLKKYMEDRSKTTNTWVLHMDGENFRIVL,KREKSGCSNWAKKHSMLELQRQKRPITLSVVLLMNILWKLMGKVSRSIWRTDQKPPILGYYTWMVRTLELFW,RDKKRVDVQISGQRNILCWSCKDKSDHKYRRYQWFCLIYSGNWEKSQEVYGGQIKNHQYLGITHGWELNCF

bottom of page