McDonnell Genome Institute

Washington University

CircRNA

chr3|133942604|133945260|-|SLCO2A1|ENST00000310926.8

Cancer

Type of Peptide

CCRC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9979

8

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

9

Peptide

FYLPPGLWR

Amino Acids from 5' Exons

IYLNCSCVTGGSASAKTGSCPVPCAHFLLPAIFLISFVSLIACISHNPLYMMVL,SITAAVPGDPLQQRQDRALSPVPTSCSRPSSSSPSCPPASPTTPSTWFC,LFELQLCDRGIRFSKDRIVPCPLCPLPAPGHLPHLLRVPDSLHLPQPPLHDGSA

Amino Acids from 3' Exons

HIKFYTSAVSCLPQGLLVPRFYLPPGLWRQWNRVPLPLPCRLQQHQHELCNLQAT,TSSSIHPQSPACRRDCSCPDSIFHPVCGDNGIEYLSPCHAGCSNINMSSATSKQL,HQVLYIRSLLPAAGTARAQILSSTRSVETMESSTSPLAMPAAATSTALQPPSN