McDonnell Genome Institute

Washington University

CircRNA

chr3|133620154|133623457|-|TOPBP1|ENST00000260810.9

Cancer

Type of Peptide

BRCA-Basal-like

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9797

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

3

Peptide

VLEALSVPK

Amino Acids from 5' Exons

FHRPRERTFRSSYRRCLQHQNPKGRGLPFQEVVVTAHLQPLTALALLAVDEVESRH,SDTDLRDERELSEAVTGDNVCNINSETPRAEDFPFKKWLQRIFNPQHSLCSQWTKSPRGTE,LTQTLEMRENFQKQLQEIMSATSIVKPQGQRTSLSRSGCNSASSTPDSTRSARSGRSRVLEAL

Amino Acids from 3' Exons

CAQECKHLPESLYPHTYNPKMSLDISAVQDGRLCNSRLLSAVSSTKDDE,VPKSVNIFLNLFIHILIIPKAWISAQCKMAGSVIVDYSQLCLQQRMM,CPRVTSSISLSTYLSQNELGYQRSARWPALSTTLSCVFNKG