McDonnell Genome Institute

Washington University

CircRNA

chr3|133584001|133586722|+|CDV3|ENST00000264993.7

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

15

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

10

2

Peptide

NSEKEEDDNEKR

Amino Acids from 5' Exons

QKGRRRKETRSRLGRRWRWWWRYGKIFRSLENSSSTSTSCSSN,SEKEEDDNEKRQDPGDNWEEGGGGGGGMEKSSGPWNKTAPVQAPPAPVI,VKRKKTIMKRDKIQVITGKKVEVVVEVWKNLQVPGIKQLQYKHLLLQL

Amino Acids from 3' Exons

LQKPQNQRLVVCIGLLGPGPQQGKHHKDHQKSTVIHSSHPCSQLPSMKAG,YRNPRTSDDWCVASWGQVNHNKENTTRTTRNLQYTVPIPAVNCQACRKPE,TETPEPAMTSGVYRPPGARLTTTRKTPQGPPEIYSDTQFPSLQSTAKHVESR