McDonnell Genome Institute

Washington University

CircRNA

chr3|13358221|13360491|-|NUP210|ENST00000254508.6

Cancer

Type of Peptide

BRCA-Luminal B

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9866

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

16

Peptide

QVAVDPSSVALVTLGSSK

Amino Acids from 5' Exons

VIALSVGNKPSLTNPFPAVEPAVVKFVCAPPSRLTLAPVYTSPQLDMSCPLLQQNKQV,SSPCRWGTSPASPTPFLRWSLPWSSSAPHRPGSPSRLSTPAPSWTCPVRCCSRTSR,HRPVGGEQAQPHQPLSCGGACRGEVRLRPTVQAHPRACLHQPPAGHVLSAAAAEQAG

Amino Acids from 3' Exons

AVDPSSVALVTLGSSKEMLFEGGPRPWILEPSKFFQNVTAEDTDSIGLALFAPHSSRNYQQHWILVTCQALGEQ,LWIPPLLPWPWAPQRRCCLKEVPDLGSSSRPNSSRTSPLRTLTASAWLSLPPIPPGIISNTGSLPVRPWVS,CGSLLCCLGNPGLLKGDAVRRSQTLDPRAVQILPERHRGHQHRPGSLCPPFLPELSATLDPCDLSGLGA