McDonnell Genome Institute

Washington University

CircRNA

chr3|132511066|132531097|+|DNAJC13|ENST00000260818.10

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9407

8

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

15

Peptide

HDLFISESQTAGYLTGSK

Amino Acids from 5' Exons

VPKAFAASLLDYIGSQAQYLHTFMAITHAAKVESEQHGDRLPRVEMALEALRNVIKYNP,FQKHLLQVSWIIARRPNTCTHSWPSHTRQKWSQSNMEIAYREKWLWRLEMSNTIQ,SKSICCKSLGLYRLAGPILAHIHGHHTRGKSGVRATWRSLTESRNGFGGSEKCHKIQS

Amino Acids from 3' Exons

VNEILCRSSVWSAFKDQKHDLFISESQTAGYLT,MKSCAVLQSGVPSKIRNMICSFLSHKQQDTSQ,ENPVPFFSLECLQRSETFVHFVTNSRIPH