McDonnell Genome Institute

Washington University

CircRNA

chr3|132496527|132503381|+|DNAJC13|ENST00000260818.10

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9045

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

9

Peptide

KLAVASVTEDMFEK

Amino Acids from 5' Exons

DMFEKVNKAYEFLCTKSAKIVDGPDPENIILILKTQSILFNRHKE,TCLKKIKHMNFYVPNQQKWMGQIQRIFFKHRASSSTVIKK,HVKSKSIIFMYQISKNSGWARSREYNFNSKNTEHPLQPSR

Amino Acids from 3' Exons

EVANSLAKLSVHALSRLGGYLAEEQATPENPTIRKSLAGMLTPYVARKLAVASVTE,RQTALPNVSMLVALEGIWLKNKQLQKIQPGKALACHPMLLENLLWLVL,GSKQPCQTECPCSESPWRVFGRTSNSRKSNHKEKLSWHADTLCCKTCCGCD