McDonnell Genome Institute

Washington University

CircRNA

chr3|132494143|132499310|+|DNAJC13|ENST00000260818.10

Cancer

Type of Peptide

BRCA-Luminal B

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9503

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

5

Peptide

ENGLEVK

Amino Acids from 5' Exons

VKLLKDTLDAWKKEVEKKPPMMSIDDAYEVLNLPQGQG,LSFKIPLMPGRKKKRSHLCQMMLMKCLICLKDRD,ASKRYPCLEERSRKEATYDVNRCLSASASRTGT

Amino Acids from 3' Exons

IYSLINMQDTPCLFGLQWKLQMTSFSQKNHHCCLRLQSLSILSTVQPSMLKSSEERMD,FTALICRIPHAYSDYNNGNFRPPFLKRITIVACGYRASFPYCQLFSPQCRAQKREWTR,LQPYKYAGYPMLIRTITMETSDDLLFSKESPLLPAATELAFHTVNCSALNAEELRRENGLE