McDonnell Genome Institute

Washington University

CircRNA

chr3|130680612|130708492|-|PIK3R4|ENST00000356763.7

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9135

22

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

10

9

Peptide

KIIEGTEVVQGMTEEEEDK

Amino Acids from 5' Exons

VLGLGLPRKVLCCCRKYFPICVLLQENNRHSCP,FWDLAYPERSYVVAGSTSSPSVSYYRKIIEGTEVVQ,FGTWLTQKGPMLLQEVLVPHLCPTTGKLKALKLS

Amino Acids from 3' Exons

GMTEEEEDKLLALKDFMMKSNKAKANIVDQSHLHDSSQKGVIDLAALGITGRQVDLVKTKQEPDDKR,EQRKRKTNFWHKTSNLIKQRPIWTRAIFMIVVRKVLTWQLALGDKLILLKPNKNQMTNG,NDRGRGRQTSGTERLHDEISKGQYSGPEPSSSERCNLGSFRHNWETSSCNQTRTRQT