McDonnell Genome Institute

Washington University

CircRNA

chr3|129476314|129479922|+|IFT122|ENST00000296266.7

Cancer

Type of Peptide

PRAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9507

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

11

Peptide

EGLLVGLKNGQIGK

Amino Acids from 5' Exons

IGKDRALNFDPCCISYFTKGEYILLGGSDKQVSLFTKDGVRLGTVGEQNSWVWTCQAKPDSNYV,LERIGHTLTPAASATLLKASTFCWGVQTSKYLFSPRMECGLGLLGSRTPGCGRVKRNRIPTM,WKGSGTELPLLHQLLYRRVHFAGGFRQASISFHQGWSAAWDCWGAELLGVDVSSETGFQLC

Amino Acids from 3' Exons

EKRLQCLSFSGVKEREWQMESLIRYIKVIGGPPGREGLLVGLKNGQ,RNGCSACPSAERSGSGRWSLSFVTSRSVALLEEKASWGRMD,ETAAVPVLQRSEGAGVADGVSHSLHQGDRWPSWKRRPLSGAEEWT