McDonnell Genome Institute

Washington University

CircRNA

chr3|129461227|129464781|+|IFT122|ENST00000296266.7

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

12

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

19

Peptide

IERPGGSLSPIWSICWNPSR

Amino Acids from 5' Exons

AQCYTMCLLQSYYSSTGILFLQL,HNDAIQCVSYNPITHQLASCSSSDF,TMMLYNVSPTILLLINWHLVPPVTL

Amino Acids from 3' Exons

LDKWSVPGAGDVQWDHQHTEQKWRGESKDRAAGGLPLANMVHLLEPFK,WTNDGQYLALGMFNGIISIRNKNGEEKVKIERPGGSLSPIWSICWNPS,GQMMVSTWRWGCSMGSSAYGTKMARRKRSSGRGAPSRQYGPSAGTLQ